DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and KCNA7

DIOPT Version :9

Sequence 1:NP_001303569.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_114092.2 Gene:KCNA7 / 3743 HGNCID:6226 Length:456 Species:Homo sapiens


Alignment Length:428 Identity:275/428 - (64%)
Similarity:320/428 - (74%) Gaps:30/428 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 CERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGG 160
            |||:|:||:||||||:.|||.:||||||||||||.|::|..|.||||||.||||||:||||||||
Human    12 CERLVLNVAGLRFETRARTLGRFPDTLLGDPARRGRFYDDARREYFFDRHRPSFDAVLYYYQSGG 76

  Fly   161 RLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQA 225
            |||||.:||||||.||:.||.||..|:.:.|||||.....|||||.....|::|||||:||||||
Human    77 RLRRPAHVPLDVFLEEVAFYGLGAAALARLREDEGCPVPPERPLPRRAFARQLWLLFEFPESSQA 141

  Fly   226 ARVVAIISVFVILLSIVIFCLETLPEFKHYK------------VFNTTTNGTKIEEDEVPDI--T 276
            |||:|::||.|||:|||:|||||||:|:..:            .|....||:.......|.:  .
Human   142 ARVLAVVSVLVILVSIVVFCLETLPDFRDDRDGTGLAAAAAAGPFPAPLNGSSQMPGNPPRLPFN 206

  Fly   277 DPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLP 341
            ||||::|||||.||:|||.||.|.||:|..|.::|||:||.:||:|||:.|.|.:|.:...    
Human   207 DPFFVVETLCICWFSFELLVRLLVCPSKAIFFKNVMNLIDFVAILPYFVALGTELARQRGV---- 267

  Fly   342 KAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIG 406
                      ..|||||||||||||||||||||||||||||||||:||:||||||||||||||||
Human   268 ----------GQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIG 322

  Fly   407 VVLFSSAVYFAEAGSDSSFFKSIPDGFWWAVVTMTTVGYGDMRPVGVWGKIVGSLCAIAGVLTIA 471
            ||||||||||||.....|.|.|||:.||||||||||||||||.||.|.||||||||||||||||:
Human   323 VVLFSSAVYFAEVDRVDSHFTSIPESFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTIS 387

  Fly   472 LPVPVIVSNFNYFYHRETDQEEMQSQNFNHVTSCPYLP 509
            ||||||||||:|||||||:.||  :..|:||...|..|
Human   388 LPVPVIVSNFSYFYHRETEGEE--AGMFSHVDMQPCGP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_001303569.1 BTB_2 99..187 CDD:280393 64/87 (74%)
BTB 99..182 CDD:197585 62/82 (76%)
Ion_trans 274..488 CDD:278921 151/215 (70%)
Ion_trans_2 403..479 CDD:285168 62/75 (83%)
KCNA7NP_114092.2 BTB_2 15..105 CDD:280393 65/89 (73%)
BTB 15..98 CDD:197585 62/82 (76%)
Ion_trans 200..404 CDD:278921 152/217 (70%)
Ion_trans_2 319..398 CDD:285168 65/78 (83%)
Selectivity filter. /evidence=ECO:0000250 358..363 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 362 1.000 Domainoid score I953
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48093
OrthoDB 1 1.010 - - D307298at33208
OrthoFinder 1 1.000 - - FOG0000074
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11537
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.