DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and Kcnk9

DIOPT Version :10

Sequence 1:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_006520831.1 Gene:Kcnk9 / 223604 MGIID:3521816 Length:604 Species:Mus musculus


Alignment Length:119 Identity:26/119 - (21%)
Similarity:54/119 - (45%) Gaps:17/119 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 RTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPV 451
            |..:.||..:..:.||..:|.:...:|. |::. .:.|||    .|:::..:|:||:|:||...:
Mouse   352 RNTEVSMENMVTVGFFSCMGTLCLGAAA-FSQC-EDWSFF----HAYYYCFITLTTIGFGDFVAL 410

  Fly   452 GVWGKI--------VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEMQSQ 497
            ...|.:        ...:..:.|:..|...:.::|..   |....||:|.::.:
Mouse   411 QAKGALQRKPFYVAFSFMYILVGLTVIGAFLNLVVLR---FLTMNTDEELLEGE 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 23/108 (21%)
Kcnk9XP_006520831.1 Ion_trans_2 <275..334 CDD:462301
Ion_trans_2 372..445 CDD:462301 15/78 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.