DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and rpl-37.1

DIOPT Version :10

Sequence 1:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_497072.1 Gene:rpl-37.1 / 175141 WormBaseID:WBGene00012179 Length:92 Species:Caenorhabditis elegans


Alignment Length:63 Identity:14/63 - (22%)
Similarity:24/63 - (38%) Gaps:17/63 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 CVLCNHQMPKTVTVQEHMEKEHNI--RLVFNCRCCNWSFATRRCLMSHVECLKKAGDARNVKP 398
            ||:        :.|..|....|||  |:       :|.|......:|.:..|:...:.:.|:|
 Worm   142 CVV--------LAVWIHPSTSHNILNRI-------SWGFCVYLEAVSVLPQLRVMQNTKIVEP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 14/63 (22%)
rpl-37.1NP_497072.1 PTZ00073 1..91 CDD:240257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.