DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and Kcnk4

DIOPT Version :10

Sequence 1:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_006526780.1 Gene:Kcnk4 / 16528 MGIID:1298234 Length:427 Species:Mus musculus


Alignment Length:97 Identity:33/97 - (34%)
Similarity:45/97 - (46%) Gaps:23/97 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 LGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMT 449
            |.|:|.|        :.||.||.:||.....|..:..| |:.|.  :|.::.:||:||||:||..
Mouse   196 LVRSLSA--------VLFLLIGCLLFVLTPTFVFSYME-SWSKL--EAIYFVIVTLTTVGFGDYV 249

  Fly   450 P---VG---------VWGKIVGSLCAIAGVLT 469
            |   .|         ||..|:..|...|.|||
Mouse   250 PGDGTGQNSPAYQPLVWFWILFGLAYFASVLT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 33/97 (34%)
Kcnk4XP_006526780.1 Ion_trans_2 <135..172 CDD:462301
Ion_trans_2 210..288 CDD:462301 25/75 (33%)
PLN02983 <322..>374 CDD:215533
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.