DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh and Shab

DIOPT Version :10

Sequence 1:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_061508664.1 Gene:Shab / 1276592 VectorBaseID:AGAMI1_012264 Length:1355 Species:Anopheles gambiae


Alignment Length:73 Identity:18/73 - (24%)
Similarity:25/73 - (34%) Gaps:24/73 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 IPRMAADSILQSLKESEAQEYPDFSAASTTSSGPASTLKTPRMDFKKNLKICTDAVQILVGNGLF 465
            |||..|...||       |.:|..:||...:.|.|....|..                 |...|.
Mosquito    92 IPRHPAQLYLQ-------QRFPATAAAYGLAGGMAGAKTTSP-----------------VAASLA 132

  Fly   466 SNEQLAQT 473
            :::|:|.|
Mosquito   133 NHQQIALT 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 18/73 (25%)
ShabXP_061508664.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.