DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and CG6283

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster


Alignment Length:327 Identity:94/327 - (28%)
Similarity:138/327 - (42%) Gaps:71/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 SMSAVNATTFTTERPGGGQ--KKPTPSIDDLEGFDELSVRVIVHGFGSACPHVWIY----EMKT- 213
            |.:|||...:|...|..|:  |..:.|::|.....:...|.::||        |..    :|.| 
  Fly    61 STNAVNFYVYTKSNPTDGKEIKAKSGSVEDSHFNKDHGTRFVIHG--------WTQRYSDDMNTR 117

  Fly   214 ---ALMAVEDCIVICVDWENGATFPNYVRAAANTRLVGKQLAMLLRNLQQHKGLDLMRTHVIGFS 275
               |.::..|..||.|||.. |...:|..:.......|.::..:::.|..|.|||.....|||.|
  Fly   118 ITKAWLSKGDYNVIVVDWAR-ARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHS 181

  Fly   276 LGAHVSGFAGAELPGLSR---ITGLDPAGPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGGLG 337
            |||||:|:||..: |..|   |.|||||.|||....|..||.:.||.:|:.|.:||     |.||
  Fly   182 LGAHVAGYAGKTV-GDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNG-----GKLG 240

  Fly   338 SWQPMGHVDYYPNGGRVQTGCSNLFVGAVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSVAPRC 402
            ..:|:|...:|||||:.|.||.....|:                   |:|.|:..::.::|. ..
  Fly   241 FLKPIGKGAFYPNGGKSQPGCGLDATGS-------------------CSHARSVLYYAEAVT-ED 285

  Fly   403 LFPAFPCGNYDDFLKGRCFPCAQDDEDLAEGVPRCGN------MGYYADRSTGRGQLYLLTREEE 461
            .|.:..|.:|:|.:                 ...||:      ||...:.....|..|:....|.
  Fly   286 NFGSIKCHDYEDAV-----------------AKNCGSTYSSVRMGAITNAYMVEGDFYVPVNSEA 333

  Fly   462 PF 463
            ||
  Fly   334 PF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 92/325 (28%)
Pancreat_lipase_like 185..459 CDD:238363 81/290 (28%)
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 89/317 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445980
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.