DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and CG17191

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster


Alignment Length:321 Identity:87/321 - (27%)
Similarity:136/321 - (42%) Gaps:43/321 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 RSSVASAPSSMSAVNATTFTTERPGGGQ--KKPTPSIDDLEGFDELSVRVIVHGFGSACPHVWIY 209
            |:|:....|  :.|:...:|...|..|:  :....||:|.........|.::||:..........
  Fly    52 RNSLIETRS--NDVSFYLYTKHNPTVGKEIRADASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNV 114

  Fly   210 EMKTALMAVEDCIVICVDWENGATFPNYVRAAANTRLVGKQLAMLLRNLQQHKGLDLMRTHVIGF 274
            ::..|.::..|..||.|:|:. |...:|:.:.......|.::..::..|.:|..|.:....|||.
  Fly   115 KITRAWLSKGDYNVIVVNWDR-AQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGH 178

  Fly   275 SLGAHVSGFAGAELPG--LSRITGLDPAGPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGGLG 337
            ||||||:|:||.::.|  :..|.|||||.|||....|..||.:.||.:|:.|.:||     |..|
  Fly   179 SLGAHVAGYAGKQVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNG-----GEKG 238

  Fly   338 SWQPMGHVDYYPNGGRVQTGCSNLFVGAVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSVAPRC 402
            ..:|:|...:||||||.|.||.:...|.                   |.|.|:..:::::|. ..
  Fly   239 FLKPIGKGTFYPNGGRNQPGCGSDIGGT-------------------CAHGRSVTYYVEAVT-ED 283

  Fly   403 LFPAFPCGNYDDFLKGRCFPCAQDDEDLAEGVPRCGNMGYYADRSTGRGQLYLLTREEEPF 463
            .|....|.:|...|...|       .....||    .||...:.....|..|:....:.||
  Fly   284 NFGTIKCHDYQAALANEC-------GSTYSGV----RMGAVTNAYMVDGDFYVPVNGQAPF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 85/319 (27%)
Pancreat_lipase_like 185..459 CDD:238363 75/275 (27%)
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 82/302 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445982
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.