DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and CG6295

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:364 Identity:100/364 - (27%)
Similarity:151/364 - (41%) Gaps:73/364 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 TRQRSDRPLMELSFLNMTNAFRGKRETEVSTSSPEGTSGRSSVASAPSSMSAVNATTFTTERPGG 172
            |.:..||...| ::|...|...|:......|......|.|:|.....::.::::.:.|....|  
  Fly    36 TMEWMDREFAE-AYLETKNRMEGRNVLNPVTFYLYTNSNRNSPQEIKATSASISGSHFNPNHP-- 97

  Fly   173 GQKKPTPSIDDLEGFDELSVRVIVHGFGSACPHVWIYEMKTALMAVEDCIVICVDWENGATFPNY 237
                               .|..:||:.|:......|.::.|.....|..:|.||| ..|...:|
  Fly    98 -------------------TRFTIHGWSSSKDEFINYGVRDAWFTHGDMNMIAVDW-GRARSVDY 142

  Fly   238 VRAAANTRLVGKQLAMLLRNLQQHKGLDLMRTHVIGFSLGAHVSGFAGAELPG--LSRITGLDPA 300
            ..:......||:|:|.|:..::.:.||:|..|.|||.||||||||:||..:..  |..|.|||||
  Fly   143 ASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHTIIGLDPA 207

  Fly   301 GPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGGLGSWQPMGHVDYYPNGGRVQTGCSNLFVGA 365
            .|||....|..||.|:||.:|:.|.:||     |.||..:|:|...:|||||:.|.||.....|:
  Fly   208 LPLFSYDSPNKRLSSTDAYYVESIQTNG-----GTLGFLKPIGKGAFYPNGGKSQPGCGVDLTGS 267

  Fly   366 VTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSVAPRCLFPAFPCGNYDDFLKGRCFPCAQDDEDL 430
                               |.|.|:..::.:||... .||...||:|::.:              
  Fly   268 -------------------CAHSRSVIYYAESVTEN-NFPTMRCGDYEEAV-------------- 298

  Fly   431 AEGVPRCGN------MGYYADRSTGRGQLYLLTREEEPF 463
               ...||:      ||...:.....|..|:..|.:.|:
  Fly   299 ---AKECGSSYSSVRMGATTNAYMVAGDYYVPVRSDAPY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 99/362 (27%)
Pancreat_lipase_like 185..459 CDD:238363 85/281 (30%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 91/329 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.