DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and CG4582

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:293 Identity:85/293 - (29%)
Similarity:131/293 - (44%) Gaps:59/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 RVIVHGF-GSACPHVWIYEMKTALMAVE--DCIVICVDWENGATFPNYVRAAANTRLVGKQLAML 254
            |:::||: |:...::: .|:..|...:.  :..:..|||..|| ..:|:.|:...:.||:.||..
  Fly   166 RILIHGWLGNENANMY-NELLPAYFDLRNGNYNIFTVDWGRGA-IADYITASYRVKPVGQVLAKF 228

  Fly   255 LRNLQQHKGLDLMRTHVIGFSLGAHVSGFAGAELP--GLSRITGLDPAGPLFEAQHPKVRLDSSD 317
            :..|.|..|:......::|||:||||:|.||..|.  .|..|..||||.|.|....||.||.:.|
  Fly   229 VDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAED 293

  Fly   318 AEFVDVIHSNGENLILGGLGSWQPMGHVDYYPNGGRVQTGCSNLFVGAVTDFIWSAQAAEDEEGR 382
            |::|:|:|::     :|..|..:|:||||:|.|.|..|.||           .|..         
  Fly   294 ADYVEVLHTS-----VGSYGFDRPVGHVDFYANWGSQQPGC-----------FWHE--------- 333

  Fly   383 SLCNHRRAYKFFIDSV----APRCLFPAFPCGNYDDFLKGRCFPCAQDDEDLAEGVPRCGNMG-- 441
              |:|.||:..|.:|:    |...|....|...:....  |...|.:|     .||.:  .||  
  Fly   334 --CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLT--RFHRCPKD-----TGVMQ--TMGGD 387

  Fly   442 -------YYADRSTGRGQLYLLTREEEPFCAHQ 467
                   :.|.|   :|..|..|.::.|:...|
  Fly   388 LANVSAEFLAQR---QGVYYFQTNDQPPYVLAQ 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 83/287 (29%)
Pancreat_lipase_like 185..459 CDD:238363 83/283 (29%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 83/283 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445985
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.