DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and CG10116

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:300 Identity:83/300 - (27%)
Similarity:127/300 - (42%) Gaps:84/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 ELSVRVIVH-GFGSACPHV-----WIYEMK--------TALMAVEDCIVICVDWENGATFPNYVR 239
            |..|..:|. .|.:|.|.|     |:..:.        :|.:..:|..:|.||..         .
  Fly    39 EAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNIISVDLS---------E 94

  Fly   240 AAANTRLVGKQLAMLLRNLQQHKGLDLMRTHVIGFSLGAHVSGFAGAELP-----GLSRITGLDP 299
            |...|.:: ..:|.|:..|.....:.|.|..|:||:.|||::|...|::.     .||:||.|||
  Fly    95 ANDETEII-DSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDP 158

  Fly   300 AGPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGGLGSWQPMGHVDYYPNGGRVQTGCSNLFVG 364
            :... |..|   :|..:|||||:|:|:|.     ||.|:|:.:||||||||||:.|.||:     
  Fly   159 SSGA-ELDH---KLSQADAEFVEVVHTNA-----GGEGTWERLGHVDYYPNGGQTQPGCT----- 209

  Fly   365 AVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSVAPRCLFPAFPCGNYDDFLKGRC------FPC 423
              ||               .|:|.||::...:..:|...|.:..||:.:......|      ...
  Fly   210 --TD---------------SCSHERAFELLAEMWSPENDFVSARCGSVETLSASSCRWSTHKMGQ 257

  Fly   424 AQDDEDLAEGVPRCGNMGYYADRSTGRGQLYLLTREEEPF 463
            .|::|..|.|:                  .:|.||:..||
  Fly   258 KQEEEQPASGI------------------YFLETRQSSPF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 81/298 (27%)
Pancreat_lipase_like 185..459 CDD:238363 80/294 (27%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 79/293 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438335
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.