DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and CG10163

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster


Alignment Length:308 Identity:71/308 - (23%)
Similarity:121/308 - (39%) Gaps:72/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 PTPSIDDLEGFD---ELSVRVIVHGFGSACPHVWIYEMKTALM-AVEDCIVICVDWENGATFPNY 237
            |..||..::.||   |....:.|:.|.:|..:..:.|..|.|. :..|..||.||:........|
  Fly    97 PIKSISQIKDFDINPERKTLIYVNAFHTADSYFSVQEHLTLLQNSRRDLNVIVVDFAKDVAQLYY 161

  Fly   238 V---RAAANTRLVGKQLAMLLRNLQQHKGLDLMRTHVIGFSLGAHVSGFAGAELPG------LSR 293
            .   ..:.|...|.|    |||.|:. .|:.:....:.|.|:||:::.. ||:|..      :.:
  Fly   162 AVRHHLSVNGYFVYK----LLRALKD-AGIAVQDITLAGHSVGANIAAL-GAQLFAKENKQLVGQ 220

  Fly   294 ITGLDPAGPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGGLGSWQPMGHVDYYPNG------G 352
            :..:|||   ...:...:.:..|.|..|.|:|..|:     ..|...|:||:|.||||      .
  Fly   221 LLAIDPA---TMCRTTDILVKQSVALRVVVLHGEGD-----VFGVRVPLGHIDIYPNGIGYFPRR 277

  Fly   353 RVQTGCSNLFVGAVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSVAPRCLFPAFPCGNYDDFLK 417
            ::|.||.:                      .:|:|...:..|::::....:.||..|.::..|.:
  Fly   278 KLQPGCES----------------------KICSHMYPFILFMEALIEGVMIPATKCESWAKFRQ 320

  Fly   418 GRCFPCAQDDEDLAEGVPRCGNMG--YYADRSTGRGQLYLLTREEEPF 463
            |.|            ......|:|  |.|:   .:|..:.:|:...||
  Fly   321 GDC------------NFQNTINIGLIYPAN---AKGLYFCMTQPNPPF 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 69/306 (23%)
Pancreat_lipase_like 185..459 CDD:238363 66/294 (22%)
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 69/302 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438337
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.