DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and CG6431

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster


Alignment Length:254 Identity:76/254 - (29%)
Similarity:105/254 - (41%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 FTTERPGGGQ----KKPTPSIDDLEGFDELSVRV-IVHGFGSACPHVWIYEMKTALMAVEDCIVI 224
            ||:..|..|.    |.|......  ||.:....| |:|||......:.:..::.|.:: .|..||
  Fly    66 FTSNGPRRGTPLNVKNPITLYKG--GFSKHRETVFIIHGFNGTAIDIHLQFLRDAYLS-RDFNVI 127

  Fly   225 CVDWENGATFPNYVRAAANTRLVGKQLAMLLRNLQQHKGLDLMRTHVIGFSLGAHVSGFAGAELP 289
            .|||.....:|.|:.:..||||..:..|.:...| .|.|....|...:|.|||||:.|.....|.
  Fly   128 TVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFL-THYGAVRERITCVGHSLGAHICGMISNHLT 191

  Fly   290 GLS-RITGLDPAGPLFE-AQHPKVRLDSSDAEFVDVIHSNGENLILGGLGSWQPMGHVDYYPNGG 352
            ... ||.|||||.||.| .:..|.||...||..:.|:|:|.     |.||.....||::|..|||
  Fly   192 RKQYRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNA-----GFLGQEDNSGHLNYCVNGG 251

  Fly   353 RVQTGCSNLFVGAVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSVAPRCLFPAFPCGN 411
            |:|..|..                 :...:|.|:|..:..:...:......|...||.|
  Fly   252 RIQPFCKG-----------------NPIRKSRCSHFLSICYLATATFKHNKFMGVPCPN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 76/254 (30%)
Pancreat_lipase_like 185..459 CDD:238363 70/230 (30%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.