DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and CG17292

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:309 Identity:88/309 - (28%)
Similarity:138/309 - (44%) Gaps:66/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 IDDLEGFDEL----------SVRVIVHGFGSACPHVWIYEMKTALMAVEDCIVICVDWENGATFP 235
            |.||..|..|          :..:.:||:........|:.:..|.:..:|..:|.:||...|. .
  Fly    40 IYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELAD-G 103

  Fly   236 NYV-RAAANTRLVGKQLAMLLRNLQQHKGLDLMRTHVIGFSLGAHVSGFAGAELP-------GLS 292
            ||: .|..|.:.:|.:||.:|..:..| |||:.:.|::|.|:|..::|..|.|:.       .:.
  Fly   104 NYMFDAFPNLKQLGPELAKVLLKMFDH-GLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIK 167

  Fly   293 RITGLDPAGPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGGLGSW-----QPMGHVDYYPNGG 352
            ||:.||||.|||   :|...|.::|||||||||::          :|     ...|..|::||||
  Fly   168 RISALDPAFPLF---YPGTHLSANDAEFVDVIHTD----------AWLYGAPTSTGTADFWPNGG 219

  Fly   353 -RVQTGCSNLFVGAVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSVAPR--CLFPAFPCGNYDD 414
             .:|.||.......::|             ..|.:|||::.|:.:||:.|  ..|.|.|...:.|
  Fly   220 YSLQPGCPKRNYKMLSD-------------NDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSD 271

  Fly   415 FLKGRCFPCAQDDEDLAEGVPRCGNMGYYADRSTGRGQLYLLTREEEPF 463
            |.:.:          :.|..|.. .||::.. :|..|..||.|....||
  Fly   272 FKQNK----------IVENCPPV-VMGHHCP-TTIHGDFYLQTNGHTPF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 86/307 (28%)
Pancreat_lipase_like 185..459 CDD:238363 83/299 (28%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 85/302 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.