DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and CG18258

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster


Alignment Length:264 Identity:84/264 - (31%)
Similarity:121/264 - (45%) Gaps:59/264 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 ALMAVEDCIVICVDWENGATFPN--YVRAAANTRLVGKQLAMLLRNLQQHKGLDLMRTHVIGFSL 276
            |.:...|..|:.:|   .|.|.:  |..:|.||.::|..||..|  |:.:......:.|::|.||
  Fly   229 AYLCRNDTNVLILD---AANFIDTLYTWSALNTEVIGDYLAKAL--LRLNTSYVTKQFHLVGHSL 288

  Fly   277 GAHVSGFAG---AELPG---LSRITGLDPAGPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGG 335
            ||.::|.||   ..|.|   |.||||||||.|.|...:....|.|.||.|||:||:|.     |.
  Fly   289 GAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNP-----GM 348

  Fly   336 LGSWQPMGHVDYYPNGGRV--QTGCSNLFVGAVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSV 398
            .|:.:..|..|::.. ||:  :.||.:|      |.|             .|:|:||..::.::|
  Fly   349 FGTSKRAGDADFFVQ-GRIPFKPGCESL------DPI-------------SCSHQRAVDYWTETV 393

  Fly   399 APRCLFPAFPCGNYDDFLKGRCFPCAQDDEDLAEGVPRCGN----MGYYADRSTGRGQLYLLTRE 459
            .|         .|.:|||..||    :...:|..| ..|.|    || ||.::|..|..|:....
  Fly   394 YP---------SNGNDFLAKRC----KRYSELLLG-NYCKNTNTVMG-YAAKATDLGLFYVGANP 443

  Fly   460 EEPF 463
            |||:
  Fly   444 EEPY 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 83/262 (32%)
Pancreat_lipase_like 185..459 CDD:238363 81/258 (31%)
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 81/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446041
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.