DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and Yp3

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster


Alignment Length:274 Identity:80/274 - (29%)
Similarity:112/274 - (40%) Gaps:77/274 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 EMKTALMAVEDCIVICVDWENGATFPNYVRAA----ANT-RLVGKQLAMLLRNLQQHKGLDLMRT 269
            :.|:|..|..|.|:|    :.|:|..|:.|.|    .|| .::|:.|..|     .:||:.....
  Fly   184 QWKSAKAASGDLIII----DLGSTLTNFKRYAMLDVLNTGAMIGQTLIDL-----TNKGVPQEII 239

  Fly   270 HVIGFSLGAHVSGFAGAELPG-----LSRITGLDPAGPLFEAQHPKV--RLDSSDAEFVDVIHSN 327
            |:||..:.|||:|.||.:...     |.||||||||..|  ::.|::  .|...||:|||.||::
  Fly   240 HLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVL--SKRPQILGGLSRGDADFVDAIHTS 302

  Fly   328 GENLILGGLGSWQPMGHVDYYPNGGRVQTGCSNLFVGAVTDFIWSAQAAEDEEGRSLCNHRRAYK 392
                 ...:|:....|.||:||||.......|...:.||.                     ||.:
  Fly   303 -----TFAMGTPIRCGDVDFYPNGPSTGVPGSENVIEAVA---------------------RATR 341

  Fly   393 FFIDSVAP--RCLFPAFPCGN------YDDFLKGRCFPCAQDDEDLAEGVPRCGNMGYYADRSTG 449
            :|.:||.|  ...|||.|..:      .|.|.| |.:...|.|.||                   
  Fly   342 YFAESVRPGSERNFPAVPANSLKQYKEQDGFGK-RAYMGLQIDYDL------------------- 386

  Fly   450 RGQLYLLTREEEPF 463
            ||...|....:.||
  Fly   387 RGDYILEVNAKSPF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 78/272 (29%)
Pancreat_lipase_like 185..459 CDD:238363 78/268 (29%)
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 78/272 (29%)
Abhydrolase <215..396 CDD:304388 67/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438336
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.