DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and Lipi

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:390 Identity:131/390 - (33%)
Similarity:177/390 - (45%) Gaps:73/390 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 IVHGF---GSACPHVWIYEMKTALMAVEDCIVICVDWENGATFPNYVRAAANTRLVGKQLAMLLR 256
            |:||:   ||.  .:||::...|.:..||..:|.|||..|||...|.||..|||.|.:.|...:.
  Rat    95 IIHGYRPLGST--PMWIHKFTKAFLKQEDVNLIVVDWNQGATTFIYGRAVKNTRKVAEILREYIE 157

  Fly   257 NLQQHKGLDLMRTHVIGFSLGAHVSGFAGAELPG-LSRITGLDPAGPLFEAQHPKVRLDSSDAEF 320
            ||..| |..|...|.||.|||||:.||.|....| |.||||||||||.|..:....|||.:||:|
  Rat   158 NLLIH-GASLDNFHFIGMSLGAHICGFVGKLFQGQLGRITGLDPAGPKFSGKPSNCRLDYTDAKF 221

  Fly   321 VDVIHSNGENLILGGLGSWQPMGHVDYYPNGGRVQTGCSNLFVGAVTDFIWSAQAAEDEEGRSLC 385
            ||||||:.:     |.|..:|.||:|:||||||.|.||....:..: |:|             .|
  Rat   222 VDVIHSDSQ-----GFGILEPSGHIDFYPNGGRNQPGCPTSLLSGM-DYI-------------KC 267

  Fly   386 NHRRAYKFFIDSVAPRCLFPAFPCGNYDDFLKGRCFPCAQDDEDLAEGVPRCGNMGYYAD----- 445
            :|:||...|:::....|.|.:|||.:|.|:..|.|..|....:|      .|..:|..|:     
  Rat   268 DHQRAVHLFLEAFETNCNFVSFPCRSYRDYKSGLCVGCGNLYKD------SCPRLGIQANLWKEE 326

  Fly   446 ----------RSTGRGQLYLLTREEEPFCAHQFQLQI-------------FNSFNDLPLRTIGRL 487
                      |:|.    :|.|..:.|||.:.|.|.|             |....||.:....||
  Rat   327 LKKKTEEWPLRTTA----FLDTSSQNPFCTYYFALNIVALNETMKNGSLSFGLLKDLGVLEYPRL 387

  Fly   488 EAILEGDGGLNETFEISEKDDAEFFAGDIV--SKIIVPHPALGFPTTLSLHYKSYSGWLSKGLPH 550
            .........|.|...:::      |..|||  |:|.:.:.....|...:..|:..| .:.|.|.|
  Rat   388 YVKTMPFANLQEVKILAQ------FVNDIVNISRISMTYYQSTSPFCPTCEYRIKS-LVFKSLTH 445

  Fly   551  550
              Rat   446  445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 106/286 (37%)
Pancreat_lipase_like 185..459 CDD:238363 106/282 (38%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 106/282 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338926
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D247005at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.