DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and ccdc172

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:XP_031761725.1 Gene:ccdc172 / 100488746 XenbaseID:XB-GENE-6460356 Length:252 Species:Xenopus tropicalis


Alignment Length:140 Identity:26/140 - (18%)
Similarity:46/140 - (32%) Gaps:51/140 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   643 ESAKQRKDIFNLGTSFKLARNQTYPLDQGDELPWQPILVGNSLDNETAEAAES------------ 695
            |..|..|::.....::.|..|:...|.:..:...:      .||.| |||..|            
 Frog   104 EEEKFIKEVMEFNNNYGLTSNRDLLLREQAKAEME------QLDME-AEALMSEIESLKHESFHV 161

  Fly   696 ------SRSLSDSIA----------GEIFEPVLKDRRLAVNR----------------GRNLQDY 728
                  .::|||::|          .::.|.|....||...:                .:.|:.|
 Frog   162 KALQVQKKTLSDNLAQLQNTLKDVEDKLCEAVETTERLKAEKLLASQKPQSDAECLRLKKELESY 226

  Fly   729 ATTDSPEIME 738
            ::.||..:.|
 Frog   227 SSDDSEAVYE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576
Pancreat_lipase_like 185..459 CDD:238363
ccdc172XP_031761725.1 SMC_prok_B <14..>212 CDD:274008 21/114 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.