DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6847 and lipib

DIOPT Version :9

Sequence 1:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:320 Identity:104/320 - (32%)
Similarity:157/320 - (49%) Gaps:50/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 TERPGGGQKKPTPSIDDLEGFDELSVRVIVHGF-GSACPHVWIYEMKTALMAVEDCIVICVDWEN 230
            |::|.....:||              ..::||: .:..|.:||..:...|.|.:|..::.|||..
Zfish    64 TQQPLFNVTRPT--------------TFVIHGYRPTGAPPIWINHIVHLLAAQKDMNILVVDWNR 114

  Fly   231 GATFPNYVRAAANTRLVGKQLAMLLRNLQQHKGLDLMRTHVIGFSLGAHVSGFAGAELPG-LSRI 294
            ||...||:.|.||||.....:...:.:::: :|..|...|:||.||||||:||.||.|.| :.||
Zfish   115 GAANLNYLTAVANTRGTALNITRFIESMEK-EGASLDSIHLIGVSLGAHVAGFIGAMLGGRVGRI 178

  Fly   295 TGLDPAGPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGGLGSWQPMGHVDYYPNGGRVQTGCS 359
            ||||||||:|.:..|:.|||.:||:||||:|::..:..|.|     ..||:|:|.|||..|.||.
Zfish   179 TGLDPAGPMFASVSPEERLDPTDAQFVDVLHTDMNSFGLRG-----THGHIDFYANGGLDQPGCP 238

  Fly   360 NLFVGAVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSVAPRCLFPAFPCGNYDDFLKGRCFPCA 424
            .......:.|:              |:|:|:...::.|:...|....:||.:|.|||.|:|..| 
Zfish   239 KTIFSGKSYFV--------------CDHQRSVFLYLCSLNRTCSLTGYPCSSYSDFLSGQCLQC- 288

  Fly   425 QDDEDLAEGVPRCGNMGYYAD--RST----GRGQLYLLTREEEPF--CAHQFQLQIFNSF 476
               |.....  .|..:||...  |.|    |:.:.|..|..|.|:  .:::..|..:|.|
Zfish   289 ---ETFKPA--SCPVLGYDLSQWRDTLLRLGQTRAYFSTTAELPYSKTSYRVDLVTWNQF 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 100/303 (33%)
Pancreat_lipase_like 185..459 CDD:238363 95/281 (34%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 100/303 (33%)
Pancreat_lipase_like 40..324 CDD:238363 99/299 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I3973
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D247005at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6371
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.