DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps4 and VPS4B

DIOPT Version :10

Sequence 1:NP_573258.1 Gene:Vps4 / 32777 FlyBaseID:FBgn0283469 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_004860.2 Gene:VPS4B / 9525 HGNCID:10895 Length:444 Species:Homo sapiens


Alignment Length:98 Identity:18/98 - (18%)
Similarity:34/98 - (34%) Gaps:37/98 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 ALYTSVYLPVFKKHYGFFVNALKASGSGFLVGNSLTFIDLLVAQHSADLLGREKS---DLFNDVP 182
            |..::.|||.|.:                   :....:....||...::...:||   |.:|   
Human   482 ATSSTSYLPSFSQ-------------------DQQEMVPTFCAQSGVNVDRSQKSLHDDQWN--- 524

  Fly   183 EMKAHSEKVQSIPQIK--------KWIETRPAS 207
                ::..:||:..:|        |:.:|.|.|
Human   525 ----YNRAIQSLALLKVEDTISEDKFTQTDPRS 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps4NP_573258.1 MIT_VPS4 6..69 CDD:239141
RecA-like_VPS4 126..296 CDD:410929 17/93 (18%)
AAA_lid_3 323..361 CDD:465537
Vps4_C 379..439 CDD:462762
VPS4BNP_004860.2 MIT_VPS4 6..81 CDD:239141
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..117
RecA-like_VPS4 128..298 CDD:410929
AAA_lid_3 325..366 CDD:465537
Vps4_C 381..441 CDD:462762
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.