DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps4 and AT1G08270

DIOPT Version :9

Sequence 1:NP_001285396.1 Gene:Vps4 / 32777 FlyBaseID:FBgn0283469 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_973792.1 Gene:AT1G08270 / 837347 AraportID:AT1G08270 Length:132 Species:Arabidopsis thaliana


Alignment Length:129 Identity:53/129 - (41%)
Similarity:80/129 - (62%) Gaps:6/129 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HGVEYFLHTIKYEAQGEKAKDSIRAKCLQYLDRAEKLKEYLKKGKKKPIKEGGESSAKDDKDKKS 99
            :.:|||...:||| :..:.:|:|..|..:||.|||:::..|.:     :..|..|:.......|.
plant     2 NALEYFKIYLKYE-KNPRIRDAITDKFYEYLRRAEEIRAVLVE-----VGSGKGSNGDAAVATKP 60

  Fly   100 DSDDEDGDDPEKKKLQSKLEDAIVIEKPKVQWSDVAGLDAAKEALKEAVILPIKFPQLFTGKRI 163
            .:..:||.|.|:.||::.|..||:.|||.|:|:.||||::||:|||||||||:.|||.||.:.|
plant    61 KTKPKDGGDGEESKLRAGLNSAIIREKPNVKWTVVAGLESAKQALKEAVILPVNFPQFFTARAI 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps4NP_001285396.1 MIT_VPS4 6..69 CDD:239141 12/33 (36%)
RecA-like_VPS4 126..296 CDD:410929 25/38 (66%)
AAA_lid_3 323..361 CDD:407720
Vps4_C 379..439 CDD:401324
AT1G08270NP_973792.1 MIT <1..41 CDD:294211 14/39 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2329
eggNOG 1 0.900 - - E1_KOG0739
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002106
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.