DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps4 and CCP1

DIOPT Version :9

Sequence 1:NP_001285396.1 Gene:Vps4 / 32777 FlyBaseID:FBgn0283469 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_973600.1 Gene:CCP1 / 818020 AraportID:AT2G34560 Length:393 Species:Arabidopsis thaliana


Alignment Length:414 Identity:152/414 - (36%)
Similarity:223/414 - (53%) Gaps:91/414 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EKLKEYLKKGKKKPIKEGGESSAK--DDKDKKSDSDDEDG----------------------DDP 109
            :||.|.....|.:|  |.|.|:..  |..:..|...::||                      :..
plant    27 KKLPEEDVSNKDQP--EDGSSNGNNGDVNNNSSPVTNQDGNTALANGNVIREKPKKSMFPPFESA 89

  Fly   110 EKKKLQSKLEDAIVIEKPKVQWSDVAGLDAAKEALKEAVILPIKFPQLFTGKRIPWKGILLFGPP 174
            |.:.|...|...|:...|.::|..:.||:.||:.|||||::|||:|..|.|...|||||||||||
plant    90 ETRTLAESLSRDIIRGNPNIKWESIKGLENAKKLLKEAVVMPIKYPTYFNGLLTPWKGILLFGPP 154

  Fly   175 GTGKSYLAKAVATEANRSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEIDSMCS 239
            ||||:.||||||||.| :|||::|:|.::|||.|:||||::.||:|||.|.||.||:||||::.|
plant   155 GTGKTMLAKAVATECN-TTFFNISASSVVSKWRGDSEKLIRVLFDLARHHAPSTIFLDEIDAIIS 218

  Fly   240 ARSD---NENDSVRRIKTEFLVQMQGVGNDTDGILVLGATNIPWVLDSAIRRRFEKRIYIPLPEA 301
            .|..   :|:::.||:|||.|:||.|:....:.:.||.|||:||.||:|:.||.||||.:|||:.
plant   219 QRGGEGRSEHEASRRLKTELLIQMDGLQKTNELVFVLAATNLPWELDAAMLRRLEKRILVPLPDP 283

  Fly   302 HARLVMFKIHLGNTTHVLTEQDLKE------LAGKTEGYSGADISIVVRDALMEPVRKVQTATHF 360
            .||..||::       ::..|...|      |..|:|||||:||.|:.::|.|:|:|:...... 
plant   284 EARRGMFEM-------LIPSQPGDEPLPHDVLVEKSEGYSGSDIRILCKEAAMQPLRRTLAILE- 340

  Fly   361 KRVSGPSPTNHEEIVNDLLVPCSPGDQGAVEMNWMDVPSDKLFEP---PVTMRDMLKSLSRTKPT 422
                     :.|::                      ||.|:|  |   |:...|:.::||.|:|:
plant   341 ---------DREDV----------------------VPEDEL--PKIGPILPEDIDRALSNTRPS 372

  Fly   423 VNEDDLKKLR-----KFTEDFGQE 441
            .:      |.     ||.:|:|.:
plant   373 AH------LHAHLYDKFNDDYGSQ 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps4NP_001285396.1 MIT_VPS4 6..69 CDD:239141 152/414 (37%)
RecA-like_VPS4 126..296 CDD:410929 96/172 (56%)
AAA_lid_3 323..361 CDD:407720 15/43 (35%)
Vps4_C 379..439 CDD:401324 15/67 (22%)
CCP1NP_973600.1 RecA-like_VPS4-like 114..278 CDD:410917 94/164 (57%)
AAA_lid_3 306..343 CDD:407720 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D787710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.