DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps4 and nmd

DIOPT Version :9

Sequence 1:NP_001285396.1 Gene:Vps4 / 32777 FlyBaseID:FBgn0283469 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster


Alignment Length:260 Identity:100/260 - (38%)
Similarity:154/260 - (59%) Gaps:18/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VQWSDVAGLDAAKEALKEAVILPIKFPQLFTGKRIPW---KGILLFGPPGTGKSYLAKAVATEAN 190
            |.|:|:||||:..:.|:|:|:|||:...||...:: |   ||:||.||||.||:.:|||.|.||.
  Fly    94 VSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKL-WQAPKGVLLHGPPGCGKTLIAKATAKEAG 157

  Fly   191 RSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEIDSMCSARSDNENDSVRRIKTE 255
             ..|.::..:.|..||.|||:||...:|.||.:.:|.|||||||||...:|:.|::::...:||:
  Fly   158 -MRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAMMKTQ 221

  Fly   256 FLVQMQGVG-NDTDGILVLGATNIPWVLDSAIRRRFEKRIYIPLPEAHARLVMFKIHLGNTTHVL 319
            |::...|:. |....::|:||||.|..||.||.||...:.:|.||....|..:.|:.| .:..|.
  Fly   222 FMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVRRMPAQFHIGLPSETQRKDILKLIL-QSEEVS 285

  Fly   320 TEQDLKELAGKTEGYSGADISIVVRDALMEPVRKVQTATHFKRVSGPSPT----NHEEI-VNDLL 379
            .:.||..|:..|.|:||:|:..:.|:|.:..:|::.|:      ..||.|    |:..| ::|||
  Fly   286 QDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITS------RDPSATALDRNNVRITMDDLL 344

  Fly   380  379
              Fly   345  344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps4NP_001285396.1 MIT_VPS4 6..69 CDD:239141
RecA-like_VPS4 126..296 CDD:410929 73/170 (43%)
AAA_lid_3 323..361 CDD:407720 12/37 (32%)
Vps4_C 379..439 CDD:401324 1/1 (100%)
nmdNP_001285801.1 AAA 132..266 CDD:214640 58/134 (43%)
AAA 135..265 CDD:278434 56/130 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.