DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps4 and CG10793

DIOPT Version :9

Sequence 1:NP_001285396.1 Gene:Vps4 / 32777 FlyBaseID:FBgn0283469 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0029656 Length:479 Species:Drosophila melanogaster


Alignment Length:345 Identity:119/345 - (34%)
Similarity:187/345 - (54%) Gaps:52/345 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IKYEAQGEKAKDSIRAKCLQYLDRAEKLKEYLKKGKKKP----------IKEGGESSAKDDKD-- 96
            ||.|..|.||.:...||.|.               ||.|          |..|..:.|..::.  
  Fly    99 IKVEMGGGKAHEKTPAKELP---------------KKPPTTDASLANWHIGVGAATQALSNEQPL 148

  Fly    97 --KK----SDSDDED-----------GDDP-----EKKKLQSKLEDAIVIEKPKVQWSDVAGLDA 139
              ||    ::|:.:|           |||.     |.:.|...::.:|:.|..|::||||.|...
  Fly   149 QIKKMETATESNGQDNACEIEHVHLGGDDVLFSSLEWQSLAELVKTSILQENIKIKWSDVCGNQR 213

  Fly   140 AKEALKEAVILPIKFPQLFTGKRIPWKGILLFGPPGTGKSYLAKAVATEA-NRSTFFSVSSSDLM 203
            |.|.:||||:.||:|||||.....||:.:||.||||:||:.||||:.:|. .:.|||::::|.::
  Fly   214 AIELIKEAVLTPIEFPQLFAHGLKPWRSLLLHGPPGSGKTLLAKALYSETQGQVTFFNITASIMV 278

  Fly   204 SKWLGESEKLVKNLFELARQHKPSIIFIDEIDSMCSARS-DNENDSVRRIKTEFLVQMQGVGNDT 267
            |||.|||||:::.||.:|.:..||:||.|||:|:.|.|. ..:::|.:|.|.|.|..:.|:.:..
  Fly   279 SKWRGESEKILRVLFHMAAKRAPSVIFFDEIESLTSKRDRATDHESSKRFKNELLQLLDGMEHSL 343

  Fly   268 DGILVLGATNIPWVLDSAIRRRFEKRIYIPLPEAHARLVMFKIHLGNTTHVLTEQDLKELAGKTE 332
            :|:.||.:||:||.:|.|..|||||::.:.||.|..|..:....||::.. |..:.|::|...::
  Fly   344 NGVFVLASTNLPWDIDEAFLRRFEKKLLVQLPNAAERSCLINRLLGSSIS-LNPRLLEQLVEISD 407

  Fly   333 GYSGADISIVVRDALMEPVR 352
            .::|.:|.:..::..|..||
  Fly   408 HFTGDEIRLACKEISMHRVR 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps4NP_001285396.1 MIT_VPS4 6..69 CDD:239141 9/24 (38%)
RecA-like_VPS4 126..296 CDD:410929 79/171 (46%)
AAA_lid_3 323..361 CDD:407720 7/30 (23%)
Vps4_C 379..439 CDD:401324
CG10793NP_570054.2 LisH 31..56 CDD:285685
P-loop_NTPase 205..>259 CDD:304359 31/53 (58%)
AAA 238..376 CDD:214640 61/137 (45%)
AAA 242..374 CDD:278434 58/131 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D787710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23074
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.