DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7772 and Mtfp1

DIOPT Version :9

Sequence 1:NP_573257.1 Gene:CG7772 / 32776 FlyBaseID:FBgn0030883 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_080719.2 Gene:Mtfp1 / 67900 MGIID:1916686 Length:166 Species:Mus musculus


Alignment Length:146 Identity:67/146 - (45%)
Similarity:91/146 - (62%) Gaps:7/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EVDIYRDTFIRYMGYSNEIGESFRPLVPKSLVAASYGMAIGYVCTDTFDKALRL----QMEGASS 83
            |.|:||||::||:||:||:||:||.|||.::|..|||::..||..|..||..:.    ..|...:
Mouse    10 ERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVSSSYVLADAIDKGKKAGEVPSPEAGRN 74

  Fly    84 REVAVKGGDVFCWQMLASVAIPGLVINRITWATKTLLSKA---PMPVLKTVPTLVGLASIPLIIH 145
            ..:|:...|.|.||.||||||||..|||:..|:..:|...   |..|.|...|.:||.:||:|||
Mouse    75 TRMALAVVDTFVWQSLASVAIPGFTINRLCAASLYVLGTMTHWPPTVRKWTTTTLGLLAIPVIIH 139

  Fly   146 PIDSMVDRLMDATYRK 161
            |||..||.|:|::.||
Mouse   140 PIDRSVDFLLDSSLRK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7772NP_573257.1 MTP18 33..152 CDD:287521 55/125 (44%)
Mtfp1NP_080719.2 MTP18 20..146 CDD:313723 55/125 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835875
Domainoid 1 1.000 55 1.000 Domainoid score I11117
eggNOG 1 0.900 - - E1_KOG3945
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32318
Inparanoid 1 1.050 123 1.000 Inparanoid score I4725
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59249
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006222
OrthoInspector 1 1.000 - - oto92028
orthoMCL 1 0.900 - - OOG6_104944
Panther 1 1.100 - - LDO PTHR11001
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2652
SonicParanoid 1 1.000 - - X4495
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.