DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7772 and mtp-18

DIOPT Version :9

Sequence 1:NP_573257.1 Gene:CG7772 / 32776 FlyBaseID:FBgn0030883 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001123181.1 Gene:mtp-18 / 6418865 WormBaseID:WBGene00077690 Length:166 Species:Caenorhabditis elegans


Alignment Length:154 Identity:67/154 - (43%)
Similarity:95/154 - (61%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TSLKEV---DIYRDTFIRYMGYSNEIGESFRPLVPKSLVAASYGMAIGYVCTDTFDKALRLQMEG 80
            |.::|:   ||:|:|.:||:||:||:||:||.||...:|..||.:|.|||..|:.||.|:..::.
 Worm     2 TPVEEIIKKDIFRETPLRYLGYANEVGEAFRSLVKPVVVKFSYVVAFGYVAADSIDKGLQEYIKT 66

  Fly    81 AS-----SREVAVKGGDVFCWQMLASVAIPGLVINRITWATKTLLSKA---PMPVLKTVPTLVGL 137
            .|     :::||:...|...||..|||.|||..|||..:.:..||.|:   |..:.|...|.:||
 Worm    67 HSTSTEKTKKVAIAAVDTVLWQTFASVLIPGFTINRFCFFSNLLLQKSTKLPTNMRKWTVTCLGL 131

  Fly   138 ASIPLIIHPIDSMVDRLMDATYRK 161
            |:||.|:|||||.|:..||.|.||
 Worm   132 ATIPFIVHPIDSFVEEAMDKTARK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7772NP_573257.1 MTP18 33..152 CDD:287521 55/126 (44%)
mtp-18NP_001123181.1 MTP18 19..149 CDD:287521 56/129 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158687
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3945
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32318
Inparanoid 1 1.050 119 1.000 Inparanoid score I3350
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59249
OrthoDB 1 1.010 - - D1477184at2759
OrthoFinder 1 1.000 - - FOG0006222
OrthoInspector 1 1.000 - - oto19635
orthoMCL 1 0.900 - - OOG6_104944
Panther 1 1.100 - - LDO PTHR11001
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2652
SonicParanoid 1 1.000 - - X4495
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.