DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7772 and MTFP1

DIOPT Version :9

Sequence 1:NP_573257.1 Gene:CG7772 / 32776 FlyBaseID:FBgn0030883 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_057582.2 Gene:MTFP1 / 51537 HGNCID:26945 Length:166 Species:Homo sapiens


Alignment Length:146 Identity:71/146 - (48%)
Similarity:92/146 - (63%) Gaps:7/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EVDIYRDTFIRYMGYSNEIGESFRPLVPKSLVAASYGMAIGYVCTDTFDKALRL----QMEGASS 83
            |.|:||||::||:||:||:||:||.|||.::|..|||:|..||..|..||..:.    ..|...|
Human    10 ERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRS 74

  Fly    84 REVAVKGGDVFCWQMLASVAIPGLVINRITWATKTLLSKA---PMPVLKTVPTLVGLASIPLIIH 145
            ..|.|...|.|.||.||||||||..|||:..|:..:|..|   |:.|.|...|.:||.:||:|||
Human    75 ARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIH 139

  Fly   146 PIDSMVDRLMDATYRK 161
            |||..||.|:|::.||
Human   140 PIDRSVDFLLDSSLRK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7772NP_573257.1 MTP18 33..152 CDD:287521 59/125 (47%)
MTFP1NP_057582.2 MTP18 20..146 CDD:371134 59/125 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145803
Domainoid 1 1.000 59 1.000 Domainoid score I10723
eggNOG 1 0.900 - - E1_KOG3945
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32318
Inparanoid 1 1.050 131 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59249
OrthoDB 1 1.010 - - D1477184at2759
OrthoFinder 1 1.000 - - FOG0006222
OrthoInspector 1 1.000 - - oto88457
orthoMCL 1 0.900 - - OOG6_104944
Panther 1 1.100 - - LDO PTHR11001
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4495
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.