DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7772 and mtfp1

DIOPT Version :9

Sequence 1:NP_573257.1 Gene:CG7772 / 32776 FlyBaseID:FBgn0030883 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_956980.1 Gene:mtfp1 / 393659 ZFINID:ZDB-GENE-040426-1293 Length:165 Species:Danio rerio


Alignment Length:153 Identity:74/153 - (48%)
Similarity:95/153 - (62%) Gaps:13/153 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TSLKEVDIYRDTFIRYMGYSNEIGESFRPLVPKSLVAASYGMAIGYVCTDTFDKALRLQMEGASS 83
            |..|.|||||||::|::||:||:||:||.|||...|.||||:|..||..|..||.   :...|:.
Zfish     7 THSKPVDIYRDTWVRFLGYANEVGEAFRALVPVGAVWASYGVATTYVTADAIDKG---RKAAAAH 68

  Fly    84 RE-------VAVKGGDVFCWQMLASVAIPGLVINRITWATKTLLSKA---PMPVLKTVPTLVGLA 138
            .|       |.|...|.|.||.|||||:||..|||:..|:..|||:.   |:||.|...|.:||:
Zfish    69 GERPGKAVCVCVAVVDTFVWQALASVAVPGFTINRVCAASHFLLSRTTRWPLPVRKWTTTAIGLS 133

  Fly   139 SIPLIIHPIDSMVDRLMDATYRK 161
            :||.||.|||..||.|:|::.||
Zfish   134 TIPFIITPIDRSVDLLLDSSLRK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7772NP_573257.1 MTP18 33..152 CDD:287521 59/128 (46%)
mtfp1NP_956980.1 MTP18 21..147 CDD:287521 59/128 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10335
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32318
Inparanoid 1 1.050 130 1.000 Inparanoid score I4621
OMA 1 1.010 - - QHG59249
OrthoDB 1 1.010 - - D1477184at2759
OrthoFinder 1 1.000 - - FOG0006222
OrthoInspector 1 1.000 - - otm25586
orthoMCL 1 0.900 - - OOG6_104944
Panther 1 1.100 - - LDO PTHR11001
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2652
SonicParanoid 1 1.000 - - X4495
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1414.010

Return to query results.
Submit another query.