DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12985 and CG14841

DIOPT Version :9

Sequence 1:NP_573255.1 Gene:CG12985 / 32774 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650350.1 Gene:CG14841 / 41735 FlyBaseID:FBgn0038218 Length:274 Species:Drosophila melanogaster


Alignment Length:197 Identity:76/197 - (38%)
Similarity:124/197 - (62%) Gaps:8/197 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 DNCDSCDEIINS--------RLKATHIAQNAAQVAKAANDAQAAAAQDASRQAKMQLAEKAISAA 163
            :.|::...:.||        :.||:.||..|||.||||||||.||.:.||.|.|..|||||:.||
  Fly    63 EGCETSSAVQNSCGLSQKNAKSKASSIAIKAAQDAKAANDAQMAAGEAASLQVKQDLAEKAVQAA 127

  Fly   164 RAADAVLEGKQAMVDNYAREIRDAEEVVGQVSCSLQNSETNVEASCAVVKAAEVQAETFRALVQQ 228
            |||:|.|.|||.:::....|.::|..||.:|..||.:::.|.|::......|::|.:..:.|:.:
  Fly   128 RAAEAALAGKQQIMEQLELEEKEAVAVVDEVKNSLHSTQVNAESAMLAFSEAKIQLDQLKVLLAE 192

  Fly   229 TSGILSEMDSLIDQSNMDIEEKNQMLAAAKARGDRLARQVAQAKSEYEQVKEAACRAASAAVEAK 293
            .:..::.:::..:.:.::::||.|:|.||..|.:.::|||..|:.:|::.|:||.:||.||||||
  Fly   193 ATAQMTNIETFANGAQLEMDEKGQLLEAANRRVESISRQVVAARQDYDKTKKAAYKAACAAVEAK 257

  Fly   294 QK 295
            ||
  Fly   258 QK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12985NP_573255.1 DUF745 117..296 CDD:283087 75/187 (40%)
CG14841NP_650350.1 DUF745 81..260 CDD:283087 73/179 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.