DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12985 and CG14840

DIOPT Version :9

Sequence 1:NP_573255.1 Gene:CG12985 / 32774 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650349.1 Gene:CG14840 / 41734 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster


Alignment Length:175 Identity:77/175 - (44%)
Similarity:119/175 - (68%) Gaps:0/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 KATHIAQNAAQVAKAANDAQAAAAQDASRQAKMQLAEKAISAARAADAVLEGKQAMVDNYAREIR 185
            ||::|||.|||.||||:|:|.|||:.|:.|.|.:||.||..:||||:|.|.|||.:|:...:|:.
  Fly    87 KASNIAQKAAQEAKAASDSQMAAAEAAASQVKNELAAKAAQSARAAEAALAGKQQIVEQLQQEMT 151

  Fly   186 DAEEVVGQVSCSLQNSETNVEASCAVVKAAEVQAETFRALVQQTSGILSEMDSLIDQSNMDIEEK 250
            :|:.||.:|:.||||::.|..|:.:....|:.|....:.||...:..|:.::::...:..::.||
  Fly   152 EADAVVTEVTSSLQNTQANANAAASAAHEAQSQLNQLKNLVIAATSNLANIENVASGAQQELAEK 216

  Fly   251 NQMLAAAKARGDRLARQVAQAKSEYEQVKEAACRAASAAVEAKQK 295
            .|:|.|||.|.:.|.||:.:||:::|:.|:||.:||.||||||||
  Fly   217 TQLLEAAKHRVENLTRQMTEAKTDFEKTKQAAYKAACAAVEAKQK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12985NP_573255.1 DUF745 117..296 CDD:283087 77/175 (44%)
CG14840NP_650349.1 DUF745 82..262 CDD:283087 77/175 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.