DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12985 and CG11694

DIOPT Version :9

Sequence 1:NP_573255.1 Gene:CG12985 / 32774 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_649786.1 Gene:CG11694 / 40985 FlyBaseID:FBgn0037571 Length:261 Species:Drosophila melanogaster


Alignment Length:207 Identity:75/207 - (36%)
Similarity:117/207 - (56%) Gaps:5/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 DRNRDRDKDRNNIRDRDNCDSCDEIIN--SRLKATHIAQNAAQVAKAANDAQAAAAQDASRQAKM 153
            |.:.|.|   |::........||..:|  :|:||:.|||.||:.|..|:|||..|.:.|:||.|.
  Fly    36 DHHGDGD---NSVSSSSGGAPCDFKMNGKTRVKASCIAQKAAKEAMEASDAQIEAGEAAARQVKQ 97

  Fly   154 QLAEKAISAARAADAVLEGKQAMVDNYAREIRDAEEVVGQVSCSLQNSETNVEASCAVVKAAEVQ 218
            |||:||::||:||:|.|.|||.:|:....|:|:.|.||.:.|..||.::|...|:....|.|..|
  Fly    98 QLADKALAAAKAAEAALAGKQQIVEQLESEVREGELVVQEESTLLQTTQTTYAAAGQAAKQAADQ 162

  Fly   219 AETFRALVQQTSGILSEMDSLIDQSNMDIEEKNQMLAAAKARGDRLARQVAQAKSEYEQVKEAAC 283
            ..|....|:.....:...:.:...:..::.||.|::.|||.|.:.|.||:..|:.:::..|.||.
  Fly   163 LNTITLAVKNAQDNVVNSEHVASGAQQELGEKQQLVEAAKKRVELLLRQLEVARVDFKNTKNAAE 227

  Fly   284 RAASAAVEAKQK 295
            :||.||.||:.:
  Fly   228 KAACAAQEARHR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12985NP_573255.1 DUF745 117..296 CDD:283087 69/181 (38%)
CG11694NP_649786.1 Ribosomal_S11 34..>95 CDD:294237 23/61 (38%)
DUF745 60..223 CDD:283087 59/162 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.