DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12985 and CG33257

DIOPT Version :9

Sequence 1:NP_573255.1 Gene:CG12985 / 32774 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_996107.1 Gene:CG33257 / 2768960 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster


Alignment Length:178 Identity:48/178 - (26%)
Similarity:90/178 - (50%) Gaps:2/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 INSRLKATHIAQNAAQVAKAANDAQAAAAQDASRQAKMQLAEKAISAARAADAVLEGKQAMVDNY 180
            |.|.|::  |||.:|..|.:|...|.|||:.|:..|:..||:.|..||..|.|.|.|||.::...
  Fly    90 IGSGLRS--IAQGSADQAHSAVTNQHAAAKQAAYIAQNTLAQAASQAAATAQAALVGKQVVLQEL 152

  Fly   181 AREIRDAEEVVGQVSCSLQNSETNVEASCAVVKAAEVQAETFRALVQQTSGILSEMDSLIDQSNM 245
            .::..:|:..:.:....|:.::.:...:....:||........|.|.....:..:.:....:.|.
  Fly   153 EQQAAEAQRSLSRELEQLKAAKISARLAQQTAQAAHHHISVLTAAVNNAKSVAEQAEQTSTEVNN 217

  Fly   246 DIEEKNQMLAAAKARGDRLARQVAQAKSEYEQVKEAACRAASAAVEAK 293
            .:..::||:..:|.|.:::..|:.||:.:|...||:|.:||::|..|:
  Fly   218 QLASQSQMVGQSKNRLEQVEEQLHQARVDYAATKESALKAANSAAAAQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12985NP_573255.1 DUF745 117..296 CDD:283087 47/177 (27%)
CG33257NP_996107.1 DUF745 94..252 CDD:283087 39/159 (25%)
SNARE 195..240 CDD:304603 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.