DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and ANGPTL1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001363692.1 Gene:ANGPTL1 / 9068 HGNCID:489 Length:491 Species:Homo sapiens


Alignment Length:440 Identity:118/440 - (26%)
Similarity:173/440 - (39%) Gaps:158/440 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KVNSSDELKNQVNAMS-ETIKDLQTRIGHKNELLLLQAGQIKDQSARLNVLIKNMKVLRSECLNA 118
            |...:..:|:.:..|. |.:||:.:|  .|.|:.:||.  :.|....   ::..:|:||.|..|.
Human    69 KGQDASTIKDMITRMDLENLKDVLSR--QKREIDVLQL--VVDVDGN---IVNEVKLLRKESRNM 126

  Fly   119 QAE------------IKSKDIQIQLSAA--KIKQMSNELV------------------------- 144
            .:.            |:.:|..::||..  ||..::.|::                         
Human   127 NSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSV 191

  Fly   145 ------TQC----SRQDT-----------------------------------CPID-------- 156
                  .||    |||||                                   .|.|        
Human   192 MITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLA 256

  Fly   157 --------------------------------GKGGIYKLKIRELPAFEAPCSSN---------- 179
                                            ...|||.:|         |.:||          
Human   257 TSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIK---------PENSNGPMQLWCENS 312

  Fly   180 ----GWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGT 240
                ||..||||.||:.||.|.|::||.|||.:.||:::|||.:::::.|..::|.|:|......
Human   313 LDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDK 377

  Fly   241 TSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWW 305
            ..:|.|.:|.|..|.|.|.|: ||.|.|.||||:..|..::|||.|:|.|.|..|||....||||
Human   378 KVYAEYSSFRLEPESEFYRLR-LGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWW 441

  Fly   306 YYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
            |..||.|.|||.:|:.|..|:...:||.|..:...  :|||..|:|||:|
Human   442 YNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGG--SYSLRAVQMMIKP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 85/210 (40%)
ANGPTL1NP_001363692.1 PB1 74..138 CDD:383100 16/70 (23%)
FReD 275..490 CDD:238040 85/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.