DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and FCN3

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_003656.2 Gene:FCN3 / 8547 HGNCID:3625 Length:299 Species:Homo sapiens


Alignment Length:201 Identity:79/201 - (39%)
Similarity:109/201 - (54%) Gaps:12/201 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 GIYKLKI---RELPAF-EAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVH 220
            |.|.|.:   |.||.| :......|||..|:|.||:.:|.|.|..|:.|||....||::|.|.:|
Human   105 GWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLH 169

  Fly   221 LMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYN-GTAGDSLRPHERQKFTT 284
            .:|.|...||.::|...:|..:.|||..|.|.||::.|:| :||::: |||||||..|..:.|||
Human   170 QLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQL-ALGKFSEGTAGDSLSLHSGRPFTT 233

  Fly   285 NDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKF-YKEGRSRNGKTNGILWGSWHNNDWTYSLTF 348
            .|.|:|:...|||...:|.|||..|.:|.|||:: ..|..:..   .||.|.|.......|..  
Human   234 YDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHK---YGIDWASGRGVGHPYRR-- 293

  Fly   349 VEMMIR 354
            |.||:|
Human   294 VRMMLR 299

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 79/201 (39%)
FCN3NP_003656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..81
FReD 90..299 CDD:238040 78/199 (39%)