DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and SMC1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_116647.1 Gene:SMC1 / 850540 SGDID:S000001886 Length:1225 Species:Saccharomyces cerevisiae


Alignment Length:311 Identity:70/311 - (22%)
Similarity:120/311 - (38%) Gaps:85/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ADNPCSAHRIWVWRPILDRFAKVNSS-------DELKNQVNAMS----ETIK-------DLQT-- 78
            |.:|....|:         |.:|:.|       :|||.::..:|    |:||       :|:|  
Yeast   159 AQSPVELSRM---------FEEVSGSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYK 214

  Fly    79 -----------RIGHKNELLLLQA-GQIKDQSARLNVLIKNMKVLRSECLNAQAEIKSKDIQIQL 131
                       ::..||||...|| .|:.....:...|...:..|.||..:.:.:|.::...:|.
Yeast   215 EGINKNEEYRKQLDKKNELQKFQALWQLYHLEQQKEELTDKLSALNSEISSLKGKINNEMKSLQR 279

  Fly   132 SAAKIKQMSNELVTQCSRQDTCPIDGKGGIYKLK---IRELPAFEAPCSSNGWLT--IQKRYDGA 191
            |.:...:.|..:..|.|:.|.        |:|.|   :.:|...:.|..:.|...  |:||.:..
Yeast   280 SKSSFVKESAVISKQKSKLDY--------IFKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESL 336

  Fly   192 ENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRR-HELYIKLGKIDGTTSHAHYDNFELG-GE 254
            :...:..|.|.:.|.          .::.::||.:. .|..||       .|..:||.|:|. .:
Yeast   337 QKDLQRQKTYVERFE----------TQLKVVTRSKEAFEEEIK-------QSARNYDKFKLNEND 384

  Fly   255 IESYEL---KSLGRYNGTAGDSLRPHERQKFTTNDK---DNDAYRFNCAAD 299
            :::|..   |.|     |.|.|:. .|:.....|||   ..:..|||..||
Yeast   385 LKTYNCLHEKYL-----TEGGSIL-EEKIAVLNNDKREIQEELERFNKRAD 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 37/153 (24%)
SMC1NP_116647.1 Smc 3..1225 CDD:224117 70/311 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.