DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and FIBCD1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001138578.1 Gene:FIBCD1 / 84929 HGNCID:25922 Length:461 Species:Homo sapiens


Alignment Length:367 Identity:109/367 - (29%)
Similarity:169/367 - (46%) Gaps:71/367 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ILDRFAKVNSS--------------------------DELKNQVNAMSETIKDLQT-----RIGH 82
            :.|.||::.|:                          |.|.:|:..:.....:|||     |.||
Human   101 LTDSFARLESAQASVLQALTEHQAQPRLVGDQEQELLDTLADQLPRLLARASELQTECMGLRKGH 165

  Fly    83 KNELLLLQAGQ----IKDQSARLNVLIKNMKVLRSECLNAQAEI-----KSKDI-----QIQLSA 133
            ..      .||    ::.:..||..|:...:...:..:|:.::|     :.:.:     :..|..
Human   166 GT------LGQGLSALQSEQGRLIQLLSESQGHMAHLVNSVSDILDALQRDRGLGRPRNKADLQR 224

  Fly   134 AKIKQMSNELVTQCSRQDTC---PIDGK--GGIYKLKIRELPA-FEAPC----SSNGWLTIQKRY 188
            |..:..........||...|   .:.|:  .|:|.:.....|| |:..|    ...||...|:|.
Human   225 APARGTRPRGCATGSRPRDCLDVLLSGQQDDGVYSVFPTHYPAGFQVYCDMRTDGGGWTVFQRRE 289

  Fly   189 DGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELG- 252
            ||:.||.|||..|:|||||:.||.::||:::|.:|.|..:||::.|...:..|::|.|.:|.:| 
Human   290 DGSVNFFRGWDAYRDGFGRLTGEHWLGLKRIHALTTQAAYELHVDLEDFENGTAYARYGSFGVGL 354

  Fly   253 ----GEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSM 313
                .|.:.|.| ::..|:|||||||..|...:|||.|:|:|....||||...|.|||.:|..|.
Human   355 FSVDPEEDGYPL-TVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSN 418

  Fly   314 LNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
            |||::.:...:  ...:|:.|.||  ..|.|||.|.||.|||
Human   419 LNGQYLRGAHA--SYADGVEWSSW--TGWQYSLKFSEMKIRP 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 83/206 (40%)
FIBCD1NP_001138578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..238 2/23 (9%)
FReD 241..457 CDD:238040 85/221 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.