DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Fgl2

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_445907.2 Gene:Fgl2 / 84586 RGDID:620170 Length:429 Species:Rattus norvegicus


Alignment Length:373 Identity:119/373 - (31%)
Similarity:170/373 - (45%) Gaps:89/373 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ELKNQVNAMSETIKDLQTRIGHKNEL------LLLQAGQIKD---------QSARLNVLIKNMKV 110
            :|..|..:|.|.:|:::|.....:.|      ..|||.:..|         :..|:..|...:..
  Rat    65 QLPQQFGSMEEVLKEVRTLQEAVDSLKKSCQDCKLQADEHPDPGGNGAETAEDNRVQELESQVNK 129

  Fly   111 LRSECLNAQAEIKSKDIQIQLSAAKIKQMS-----------------NELVTQCSRQDTCP---- 154
            |.||..||:.||:.  :|.:|.:.::..|:                 |.|.::|.:   ||    
  Rat   130 LSSELKNAKEEIQG--LQGRLESLQLVNMNNIENYVDNKVANLTSVVNSLDSKCFK---CPSQEH 189

  Fly   155 ------------------IDGK--GGIYKLKIRELP-----AFEAPC----SSNGWLTIQKRYDG 190
                              :.||  .|.|    |..|     :||..|    :..||..:|.|.||
  Rat   190 NQPNPVQHLIYKDCSDYYVLGKRSSGTY----RVTPDHRNSSFEVYCDMETTGGGWTVLQARLDG 250

  Fly   191 AENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEI 255
            :.||.|||||||.|||.:..||::|.:|:||:|:.:...|.|.|...:|.|.:|.||.|.:..|.
  Rat   251 STNFTRGWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYAVYDQFYVANEF 315

  Fly   256 ESYELKSLGRYNGTAGDSLR-----PHERQKFTTNDKDNDAY-RFNCAADEYGGWWYYDCAKSML 314
            ..|.| .||.|||||||:||     .|:.:.|||.|:|||.| ..||......|||:..|..:.|
  Rat   316 LKYRL-HLGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDACLSANL 379

  Fly   315 NGKFYKEGRSRNGKTNGILWGSW------HNNDWTYSLTFVEMMIRPR 356
            |||:|.:  ...|..|||.||:|      |...:.:|....:|||||:
  Rat   380 NGKYYHQ--RYKGVRNGIFWGTWPGVSQAHPGGYKFSFKKAKMMIRPK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 88/216 (41%)
Fgl2NP_445907.2 ApoLp-III_like <71..177 CDD:304399 22/107 (21%)
Fibrinogen_C 199..425 CDD:278572 90/232 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4104
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.