DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and ANGPTL6

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_011526650.1 Gene:ANGPTL6 / 83854 HGNCID:23140 Length:537 Species:Homo sapiens


Alignment Length:396 Identity:112/396 - (28%)
Similarity:165/396 - (41%) Gaps:97/396 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LDRFAKVNSSDELKNQVNAMSETIKDLQTRIGHKNELLLLQAGQIKDQSARLNV-LIKNMKVLRS 113
            |.|.|..:.:  :..:|.|:.:..:.|..|:|.....|..:||......|.|.. ....:.:|..
Human   146 LQRLAAADGA--VAGEVRALRKESRGLSARLGQLRAQLQHEAGPGAGPGADLGAEPAAALALLGE 208

  Fly   114 ECLNAQAEIKSKDIQIQLSAAKIKQMSNELVTQCSR-----QDTCPIDGKG-------------- 159
            ..|||.||.:....:......|.:::: :||||.|.     :..|| .|.|              
Human   209 RVLNASAEAQRAAARFHQLDVKFRELA-QLVTQQSSLIARLERLCP-GGAGGQQQVLPPPPLVPV 271

  Fly   160 ----------------------------------------------------------------- 159
                                                                             
Human   272 VPVRLVGSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHE 336

  Fly   160 --GIYKLKI-RELPAF--EAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKV 219
              |:|:|:: |.:.:.  |......||..||:|.||:.||...|:.||.||||..||:::|||.|
Human   337 QSGVYELRVGRHVVSVWCEQQLEGGGWTVIQRRQDGSVNFFTTWQHYKAGFGRPDGEYWLGLEPV 401

  Fly   220 HLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLRPHERQKFTT 284
            :.:|.:..|||.:.|....|..:.||||.|.|..|.:.|.|: ||:|:|.|||||..|..:.|:|
Human   402 YQLTSRGDHELLVLLEDWGGRGARAHYDGFSLEPESDHYRLR-LGQYHGDAGDSLSWHNDKPFST 465

  Fly   285 NDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFV 349
            .|:|.|:|..|||..:.|||||:.||.|.|||.::..|..|:...:|:.|..:...  .|||...
Human   466 VDRDRDSYSGNCALYQRGGWWYHACAHSNLNGVWHHGGHYRSRYQDGVYWAEFRGG--AYSLRKA 528

  Fly   350 EMMIRP 355
            .|:|||
Human   529 AMLIRP 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 83/199 (42%)
ANGPTL6XP_011526650.1 FReD 322..535 CDD:238040 83/216 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.