DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Fcna

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_112638.2 Gene:Fcna / 83517 RGDID:621221 Length:335 Species:Rattus norvegicus


Alignment Length:204 Identity:81/204 - (39%)
Similarity:111/204 - (54%) Gaps:26/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CPIDGKGGIYKLKIRELPAFEAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLE 217
            |.:|..||                   ||...|:|.||:.||.|.|..||.|||.:..||::|.:
  Rat   154 CDMDVDGG-------------------GWTVFQRRVDGSINFYRDWDSYKRGFGNLGTEFWLGND 199

  Fly   218 KVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRY-NGTAGDSLRPHERQK 281
            .:||:|.....||.:.|.:..|.||.|.|.:|::.||.|.|:| :||:: .|||||||..|....
  Rat   200 YLHLLTANGNQELRVDLREFQGQTSFAKYSSFQVSGEQEKYKL-TLGQFLEGTAGDSLTKHNNMA 263

  Fly   282 FTTNDKDNDAY-RFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYS 345
            |:|:|:|||.. ..||||..:|.|||:||.:|.|||: |..| |.....:||.|.|...:.::|.
  Rat   264 FSTHDQDNDTNGGKNCAALFHGAWWYHDCHQSNLNGR-YLPG-SHESYADGINWLSGRGHRYSYK 326

  Fly   346 LTFVEMMIR 354
            :  .||.||
  Rat   327 V--AEMKIR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 78/197 (40%)
FcnaNP_112638.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..114
Collagen <67..108 CDD:396114
FReD 123..333 CDD:238040 79/202 (39%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 4/26 (15%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 36/88 (41%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 291..293 1/1 (100%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 326..335 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.