DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and fibcd1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_031746424.1 Gene:fibcd1 / 779974 XenbaseID:XB-GENE-483361 Length:464 Species:Xenopus tropicalis


Alignment Length:344 Identity:108/344 - (31%)
Similarity:170/344 - (49%) Gaps:57/344 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DRFAKVNSSDELKNQVNAMS------ETIKDLQTRIGHKNELLLLQAGQIKDQSARLNVLIKNMK 109
            :|....:.||::...|:.::      |.:|.:|..:|       .:.|.:|::..|   |||   
 Frog   136 ERALLTSLSDQVAQMVSQVARQRADWENVKKVQNGLG-------AEIGALKNEQGR---LIK--- 187

  Fly   110 VLRSECLNAQAEIKS------KDIQIQLSAA--KIKQMSNELVTQCSRQDTCPIDGK-------- 158
             |.||..:..|::.|      :.:|.:|.:.  ::|.......::.||...|....|        
 Frog   188 -LLSEGQSHVAQLGSSVSEVLETVQRELGSGRPRVKADLQRAPSRSSRPRGCANGSKPRDCYDIY 251

  Fly   159 ------GGIYKLKIRELPA-FEAPC----SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEF 212
                  .|:|.:.....|: |:..|    ...||...|:|.||:.||.:||:.|:||||::.||.
 Frog   252 MSGQQEDGVYSVFPIHYPSGFQVFCDMTTDGGGWTVFQRREDGSVNFFQGWEQYRDGFGKLTGEH 316

  Fly   213 FIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELG-----GEIESYELKSLGRYNGTAGD 272
            ::||:::||:|.|..::|.|.|...:..|::|.|:.|.:|     .|.:.|.: ::..|.|||||
 Frog   317 WLGLQRIHLLTMQTHYQLRIDLEDFENATAYALYNTFGVGLFSVNPEEDGYPI-TISDYTGTAGD 380

  Fly   273 SLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSW 337
            ||..|...||||.|.|||....|||:..:|.|||.:|..|.|||::.:...:  ...:||.|.||
 Frog   381 SLGKHSGMKFTTKDMDNDHSENNCASFYHGAWWYRNCHTSNLNGQYLRGHHA--SYADGIEWSSW 443

  Fly   338 HNNDWTYSLTFVEMMIRPR 356
              ..|.|||.|.||.|||:
 Frog   444 --TGWQYSLKFTEMKIRPQ 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 81/205 (40%)
fibcd1XP_031746424.1 FReD 244..459 CDD:238040 80/219 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.