DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Angptl1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_082609.2 Gene:Angptl1 / 72713 MGIID:1919963 Length:490 Species:Mus musculus


Alignment Length:440 Identity:116/440 - (26%)
Similarity:174/440 - (39%) Gaps:158/440 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KVNSSDELKNQVNAMS-ETIKDLQTRIGHKNELLLLQAGQIKDQSARLNVLIKNMKVLRSECLNA 118
            |...:..:|:.:..|. |.:||:.:|  .|.|:.:||.  :.|....   ::..:|:||.|..|.
Mouse    68 KGQDAGTIKDMITRMDLENLKDVLSR--QKREIDVLQL--VVDVDGN---IVNEVKLLRKESRNM 125

  Fly   119 QAE------------IKSKDIQIQLS----------------AAKIKQM-----------SNELV 144
            .:.            |:.:|..::||                |.:.:::           :|:.|
Mouse   126 NSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSV 190

  Fly   145 T------QC----SRQD------------------------------------------------ 151
            |      ||    ||||                                                
Mouse   191 TITVLEEQCLRMFSRQDPHASPPLVQVVPRHSPNSHQYTPGLLGGNEIQRDPGYPRDVMPPPDLP 255

  Fly   152 TCPI---------------------------DGKGGIYKLKIRELPAFEAPCSSN---------- 179
            |.|.                           ....|||.:|         |.:||          
Mouse   256 TAPTKSPFKIPAVTFINEGPFKDCQQAKEAGHSASGIYMIK---------PENSNGLMQLWCENS 311

  Fly   180 ----GWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGT 240
                ||..||||.||:.||.|.|::||.|||.:.||:::||:.::.::.|..::|.|:|......
Mouse   312 LDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLDNIYKLSNQDNYKLMIELEDWSEK 376

  Fly   241 TSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWW 305
            ..:|.|.:|.|..|.:.|.|: ||.|.|.||||:..|..::|||.|:|.|.|..|||....||||
Mouse   377 KVYAEYSSFRLEPESDYYRLR-LGTYQGNAGDSMMWHNGKQFTTLDRDKDTYTGNCAHFHKGGWW 440

  Fly   306 YYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
            |..||.|.|||.:|:.|..|:...:||.|..:...  :|||..|:|||:|
Mouse   441 YNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGG--SYSLRAVQMMIKP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 83/210 (40%)
Angptl1NP_082609.2 RILP-like 91..207 CDD:304877 23/122 (19%)
FReD 274..489 CDD:238040 83/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.