DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Angptl6

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_011240901.1 Gene:Angptl6 / 70726 MGIID:1917976 Length:474 Species:Mus musculus


Alignment Length:448 Identity:125/448 - (27%)
Similarity:179/448 - (39%) Gaps:113/448 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LILSLSISTSLANDPQRSFDQNADNPCSAHRIWVWR-----PILDRFAKVNSSDELKNQVNAMSE 71
            |:||...:||..   .||.:...|:..:..|:.:.|     ..|.|.|....:  |.::|.|:.|
Mouse    31 LVLSPQKATSAV---CRSSEATQDSELATLRMRLGRHEELLRALQRRAAEGGA--LADEVRALRE 90

  Fly    72 TIKDLQTRIGHKNELLLLQAGQIKD----QSARLNVLIKNMKVLRSECLNAQAEIKSKDIQIQLS 132
            ....|.||:|.....|..:|....|    .:|.|.:|.:......:|.....|.::..|.|::..
Mouse    91 HSLTLNTRLGQLRAQLQQEARAEPDLGAEPAAALGLLAERALDAEAEARRTTARLQQLDAQLREH 155

  Fly   133 AAKIKQMSNEL--------------------------------------------------VTQC 147
            |..:.|.|:.|                                                  .:..
Mouse   156 AQLMSQHSSLLGRLQRACAGPERGQQQVAVPRAPCQGHHPLLIWVLPLPLAPLVPLSLVGSASNT 220

  Fly   148 SR---------------------------------------QDTCPIDGKG----GIYKLKI-RE 168
            ||                                       :|.....|.|    |:|.|:: |.
Mouse   221 SRRLDQTPEHQREQSLRQQGPPSSLLPTGHLAVPTRPVGPWRDCAEAHGAGHWQSGVYDLRLGRR 285

  Fly   169 LPAF--EAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELY 231
            :.|.  |......||..||:|.||:.||...|:.||.||||..||:::|||.||.:|.:..|||.
Mouse   286 VVAVWCEQQQEGGGWTVIQRRQDGSVNFFTNWQHYKAGFGRPEGEYWLGLEPVHQVTSRGDHELL 350

  Fly   232 IKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAYRFNC 296
            |.|....|..:.||||:|.|..|.:.|.|: ||:|:|.|||||..|..:.|:|.|:|.|:|..||
Mouse   351 ILLEDWGGRAARAHYDSFSLEPESDHYRLR-LGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNC 414

  Fly   297 AADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIR 354
            |....|||||:.||.|.|||.:|..|..|:...:|:.|..:...  .|||....|:.|
Mouse   415 ALYHRGGWWYHACAHSNLNGVWYHGGHYRSRYQDGVYWAEFRGG--AYSLKKAVMLTR 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 85/198 (43%)
Angptl6XP_011240901.1 PRK09039 57..>154 CDD:181619 23/98 (23%)
AMH_N <116..197 CDD:368070 11/80 (14%)
FReD 259..470 CDD:238040 87/213 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.