DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Angptl1

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001102853.1 Gene:Angptl1 / 679942 RGDID:1598128 Length:300 Species:Rattus norvegicus


Alignment Length:110 Identity:25/110 - (22%)
Similarity:49/110 - (44%) Gaps:22/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KVNSSDELKNQVNAMS-ETIKDLQTRIGHKNELLLLQAGQIKDQSARLNVLIKNMKVLRSECLNA 118
            |...:..:|:.:..|. |.:||:.:|  .|.|:.:||.  :.|....   ::..:|:||.|..|.
  Rat    68 KGQDAGTIKDMITRMDLENLKDVLSR--QKREIDVLQL--VVDVDGN---IVNEVKLLRKESRNM 125

  Fly   119 QAE------------IKSKDIQIQLSAA--KIKQMSNELVTQCSR 149
            .:.            |:.:|..::||..  ||..::.|::...:|
  Rat   126 NSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATR 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040
Angptl1NP_001102853.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.