DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and Angptl7

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001034643.1 Gene:Angptl7 / 654812 MGIID:3605801 Length:337 Species:Mus musculus


Alignment Length:347 Identity:116/347 - (33%)
Similarity:172/347 - (49%) Gaps:61/347 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AHRIWVWRPILDRFAKVNSSDELKNQVNAMS--ETIKDLQTRIGHKNELLLLQAGQI--KDQSAR 100
            :|.:|:.:|           .:.|.|:.|..  |.:::|:.::.:.:.||    |::  |.:|..
Mouse    16 SHPVWLQKP-----------HKRKTQLKAAGCCEEMRELKAQVANLSSLL----GELSRKQESDW 65

  Fly   101 LNVLIKNMKVLRSECLNAQAEIKSKDIQIQLSAA--KIKQMSNEL----------VTQCSRQ--- 150
            ::|:::.|::          |..||.::.:||.|  |..:|:|::          |||.|..   
Mouse    66 VSVVMQVMEL----------ESSSKHMESRLSTAESKYSEMNNQIDIMQLQAAQTVTQTSADAIY 120

  Fly   151 DTCPIDGK----GGIYKLKIREL---PAFEAPC----SSNGWLTIQKRYDGAENFDRGWKDYKDG 204
            |...:..|    .|:|||...|.   |..|..|    |..||..||:|..|..:|.:.|:.||.|
Mouse   121 DCSSLYQKNYRISGVYKLPPDEFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWRQYKQG 185

  Fly   205 FGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGT 269
            ||.:||:|::|.|.:|.:||| ...|.::|...:|...:|.|..|.||.|:.||.| .||.|:|.
Mouse   186 FGSIRGDFWLGNEHIHRLTRQ-PSRLRVELEDWEGNARYAEYSYFALGNELNSYRL-FLGNYSGN 248

  Fly   270 AG-DSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGIL 333
            .| |:|..|....|:|.|||||.....||....||:||..|..|.|||.:|:.|..|. ..:||.
Mouse   249 VGKDALLYHNNTVFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHRK-HMDGIS 312

  Fly   334 WGSWHNNDWTYSLTFVEMMIRP 355
            |..||..:  |||..|||.|||
Mouse   313 WYGWHGAN--YSLKRVEMKIRP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 86/204 (42%)
Angptl7NP_001034643.1 FReD 120..332 CDD:238040 86/216 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4167
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.