DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and fibcd1b

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_005171959.1 Gene:fibcd1b / 567525 ZFINID:ZDB-GENE-070424-245 Length:492 Species:Danio rerio


Alignment Length:346 Identity:115/346 - (33%)
Similarity:173/346 - (50%) Gaps:57/346 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DRFAKVNSSDEL------KNQVNAMSETIKDLQTRIGHKNELLLLQAGQIKDQSARLNVL----I 105
            ||...||.::|:      ..|:....|:::..|:.:|  .:|..||.    :||..:.:|    |
Zfish   161 DRALLVNLAEEVAKLSAHAGQLKMDYESLRRGQSNLG--QDLNTLQT----EQSRLIQLLSESQI 219

  Fly   106 KNMKVLR--SECLNA--------QAEIKSKDIQIQLSAAKIKQMSN--------ELVTQCSRQDT 152
            ..:||:.  |:.|||        :|.:|:...:..:...::|..:|        ::.....|:| 
Zfish   220 NMVKVVNSVSDALNAMQKETGGLKARVKADLQRAPVRGVRLKGCANGSRPRDCSDIYASGQRED- 283

  Fly   153 CPIDGKGGIYKLKIRELPA-FEAPC----SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEF 212
                   |||.:.....|| |:..|    ...||..||:|.||:.||.|.|..|::|||::.||:
Zfish   284 -------GIYSVFPTHYPAGFQVYCDMSTDGGGWTVIQRREDGSVNFFREWDSYREGFGKITGEY 341

  Fly   213 FIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELG-----GEIESYELKSLGRYNGTAGD 272
            ::||:::|.::.|..:||.|.|...:.:|:.|.|..|.:|     .|.:.|.| ::..|.|||||
Zfish   342 WLGLKQIHALSIQGNYELRIDLEDFENSTAFAQYGVFGVGLFSVDPEDDGYPL-TIADYTGTAGD 405

  Fly   273 SLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSW 337
            ||..|...||||.|:|||....|||:..:|.|||.:|..|.|||: |..|: .....:||.|.||
Zfish   406 SLLKHNGMKFTTKDRDNDHSENNCASFYHGAWWYRNCHTSNLNGQ-YLRGQ-HTSYADGIEWSSW 468

  Fly   338 HNNDWTYSLTFVEMMIRPRID 358
              ..|.|||.|.||.|||..|
Zfish   469 --TGWQYSLKFTEMKIRPTRD 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 85/205 (41%)
fibcd1bXP_005171959.1 FReD 269..484 CDD:238040 86/227 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm25543
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.