DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and fgl2a

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001020710.1 Gene:fgl2a / 565637 ZFINID:ZDB-GENE-030131-9506 Length:451 Species:Danio rerio


Alignment Length:468 Identity:129/468 - (27%)
Similarity:201/468 - (42%) Gaps:137/468 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MKTAYLILILSLSISTSL---ANDPQRSFDQ-NADNPCSAHRIWVWRPILDRFAKVNSSDE---- 61
            ||..|:...|.::|...:   .:.|....|: ...:.||..|:   ||.    .|....:|    
Zfish     1 MKLVYVCCSLLIAIWQEVEASGSGPSGVVDRAPGASSCSQVRL---RPA----GKCEDEEECPYQ 58

  Fly    62 ---------LKNQVNAMSETIKDLQT------RIGHKNELLLLQAGQI-----KDQ--------- 97
                     |..|...:.:|:|:||:      |:  |:..|.....|:     ||.         
Zfish    59 ITMPPLTIQLPKQFRLLEKTVKELQSLKETVNRL--KSSCLECSLKQVDLNLQKDSGDPPTEGEQ 121

  Fly    98 -----SARL--------NVLIKNMKV----LRSECLNAQAEIKS-------------KDIQ--IQ 130
                 |.|:        |.:::||:|    :.|...||:|:|.|             ::::  :.
Zfish   122 SRGQTSMRVIHNGNDSDNDIVQNMQVKMNRMSSSLKNARAQINSLQGRLEELNLLNLQNVENIVD 186

  Fly   131 LSAAKIKQMSNELVTQCSRQDTCPIDGKGGIYKLKIRELP------------------------- 170
            .....|..|.|::.:.|:   :||  |:    :|:::.|.                         
Zfish   187 RKVENITGMVNKISSTCT---SCP--GQ----QLQLQHLTNIPPRDCSDISMLGQRINKVYQVTP 242

  Fly   171 -----AFEAPCS----SNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQR 226
                 :|...|.    ..||..||.|.:|:.:|:|.|.|||.|||.:..||::|.:|:||:|:.:
Zfish   243 DPRNGSFAVYCDMESFGGGWTVIQHRINGSVSFNRTWADYKKGFGNLNSEFWLGNDKIHLLTKAK 307

  Fly   227 RHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLR-----PHERQKFTTND 286
            ...|.|:|...:||..:|.||.|.:..|...|.| |:..|:||||::|:     .|:::.|||.|
Zfish   308 DMILRIELEDSEGTRGYAKYDQFYVSNEFLHYRL-SVSGYSGTAGNALQFSKHFNHDQKFFTTPD 371

  Fly   287 KDNDAY-RFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTF-- 348
            ||||.| ..||.|....|||:..|..:.||||:||  ....||.:||.||:|.|....|..|.  
Zfish   372 KDNDRYPSGNCGAYYGSGWWFDACMSANLNGKYYK--TKYKGKRDGIFWGTWPNATSEYYPTSFR 434

  Fly   349 -----VEMMIRPR 356
                 |:|||||:
Zfish   435 QAYKNVKMMIRPK 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 83/242 (34%)
fgl2aNP_001020710.1 FReD 219..447 CDD:238040 81/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.