DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and angptl6

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001014821.1 Gene:angptl6 / 561927 ZFINID:ZDB-GENE-030131-9735 Length:489 Species:Danio rerio


Alignment Length:363 Identity:113/363 - (31%)
Similarity:165/363 - (45%) Gaps:76/363 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ELKNQVNAMSETIKDLQTRIGHKNELLLLQA-GQIKDQSARLNVLIKNMKVLRS---------EC 115
            :|.:::....|.::: |.|:    |.|||.| .|:...|:....|.|....|.|         ..
Zfish   134 QLLSEIIQKKEQVEE-QRRL----EGLLLNATSQLHQVSSNYRDLEKKYDTLASLVNNQSKIITL 193

  Fly   116 LNAQAEIKSKDIQIQLSAAKIKQMSNELVT------QCSRQDTCPI--------------DGKG- 159
            |..|.::|:...::|.:.:...|.|:.||.      ...|..:.|.              |..| 
Zfish   194 LEKQCQLKTSTKELQEATSLPAQQSSVLVNINTEPKDVQRDQSAPFHQAQARQELLETFDDSPGP 258

  Fly   160 --------------------------------GIYKLKIREL-PAFEAPC----SSNGWLTIQKR 187
                                            |||.|:.|.. ...:|.|    :..||..||:|
Zfish   259 PTETPFISFPSTKSPGPWHDCHNVLESGEKTSGIYLLRPRNTNRLLQAWCDQSRAQGGWTVIQRR 323

  Fly   188 YDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELG 252
            .||:.||.|.|..||.|||.:.||:::|||.::.:|.|..::|.:.:....|...:|.||:|.:.
Zfish   324 QDGSVNFFRTWDQYKQGFGNLDGEYWLGLEHLYWLTSQATYKLRVAMEDWQGRQVYAEYDSFRVE 388

  Fly   253 GEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGK 317
            .|.:.|.|: ||.|.|||||||..|..:.|||.|:|.|||..|||..:.|||||:.||.|.|||.
Zfish   389 PESDWYRLR-LGSYQGTAGDSLSWHNNKAFTTLDRDKDAYTGNCAHYQKGGWWYHMCAHSNLNGV 452

  Fly   318 FYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
            :|:.|..|:...:|:.|..:|..  :|||..|.|||:|
Zfish   453 WYRGGHYRSRYQDGVYWAEFHGG--SYSLKKVAMMIKP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 86/201 (43%)
angptl6NP_001014821.1 DUF1640 <46..150 CDD:285090 2/16 (13%)
DUF4349 <126..230 CDD:305044 23/100 (23%)
FReD 274..488 CDD:238040 85/216 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm25543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.