DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and MGC107780

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001015692.1 Gene:MGC107780 / 548409 -ID:- Length:308 Species:Xenopus tropicalis


Alignment Length:205 Identity:77/205 - (37%)
Similarity:106/205 - (51%) Gaps:25/205 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CPIDGKGGIYKLKIRELPAFEAPCSSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLE 217
            |.:|..||                   ||:..|:|:||:.:|.|.|..||.|||....||::|.:
 Frog   128 CDMDTDGG-------------------GWIVFQRRWDGSVDFFRDWDSYKKGFGSQLSEFWLGND 173

  Fly   218 KVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYN-GTAGDSLRPHERQK 281
            .:|.:|....::|.|.....:...|.|.||:|...||.::|:| .||.|: |||||||..|....
 Frog   174 NIHTLTSAGTYKLRIDFTDFENQNSFAAYDSFATLGEKDNYKL-ILGAYSGGTAGDSLNHHRNCP 237

  Fly   282 FTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSL 346
            |:|.|:|||.:..|||....|||||..|..|.||| .|..|:..| :..||.|.:...|.::|.:
 Frog   238 FSTKDRDNDFHNINCADTFKGGWWYGSCHDSNLNG-LYLRGKHSN-EALGINWETGKGNGYSYKV 300

  Fly   347 TFVEMMIRPR 356
            |  ||..||:
 Frog   301 T--EMKFRPK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 73/196 (37%)
MGC107780NP_001015692.1 Collagen 41..>70 CDD:189968
FReD 98..308 CDD:238040 76/203 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.