DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and angptl1a

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001014820.1 Gene:angptl1a / 544656 ZFINID:ZDB-GENE-040724-269 Length:480 Species:Danio rerio


Alignment Length:350 Identity:108/350 - (30%)
Similarity:157/350 - (44%) Gaps:72/350 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ELKNQV-NAMSETI------KDLQTRIGHKNELLLLQAGQIKDQSARLNVLIKNMKVLRSECLN- 117
            :|:|:| |..:|.:      |:|:.|...       .||.:.:||    |||   ..|...||. 
Zfish   146 QLENRVLNVTTEMLRLASRYKELEMRFAG-------LAGTVNNQS----VLI---AALEERCLRG 196

  Fly   118 -AQAEIKSKDIQIQLSAAKIKQMSNELVTQCSR---------------------------QDTCP 154
             .:.::.:....:|:....|...:|....:..|                           |.|..
Zfish   197 YGRQDLPAVPPLVQVVPESIPANNNRFTNEIQRDNNNRAFPRGSRMDTPTPDPLGIPPPPQGTLT 261

  Fly   155 IDG--------------KGGIYKLKI----RELPAF-EAPCSSNGWLTIQKRYDGAENFDRGWKD 200
            .||              ..|:|.||.    |.:.|: |....:.||...|:|.||:.||.|.|::
Zfish   262 ADGPFKDCSQVRQAGHSTSGMYLLKAEGSDRLIQAWCEHKLDNGGWTVFQRRKDGSVNFFRNWEN 326

  Fly   201 YKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGR 265
            ||.|||.:.||.::|||.::.:.:|..::|.::|....|...:|.|.:|.|..|.|.:.|: ||.
Zfish   327 YKKGFGNIDGEHWLGLENIYNLAKQGDYKLLVELEDWVGKKVYAEYSSFHLEPESEGFRLR-LGT 390

  Fly   266 YNGTAGDSLRPHERQKFTTNDKDNDAYRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTN 330
            |.|.|||||..|..:.|||.|:|.||:..|||....|||||..|.::.|||.:|..|..|:...:
Zfish   391 YQGNAGDSLTSHNGKPFTTLDRDKDAFTGNCAHFHKGGWWYNACGQTNLNGVWYSGGVYRSKFQD 455

  Fly   331 GILWGSWHNNDWTYSLTFVEMMIRP 355
            ||.|..:...  .|||..|.|||||
Zfish   456 GIFWAEYGGG--YYSLKSVRMMIRP 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 81/200 (41%)
angptl1aNP_001014820.1 FReD 264..479 CDD:238040 82/217 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.