DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and ANGPT4

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_057069.1 Gene:ANGPT4 / 51378 HGNCID:487 Length:503 Species:Homo sapiens


Alignment Length:387 Identity:111/387 - (28%)
Similarity:174/387 - (44%) Gaps:65/387 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSISTSLANDPQRSFDQNADNPCSAHRIWVWRPILDRFAKVN--------SSDELKNQVNAMSET 72
            |.:.|||.|.......:..|....         :|::.::::        |:::|:||:....:.
Human   132 LELGTSLLNQTTAQIRKLTDMEAQ---------LLNQTSRMDAQMPETFLSTNKLENQLLLQRQK 187

  Fly    73 IKDLQTRIGHKNEL-LLLQAGQIKDQSARLNVLIKNMKVLRSECLNAQAE-----------IKSK 125
            ::.||   |..:.| ..|||.:.|.|....::|.|..|:|.:  |:.|:.           ::..
Human   188 LQQLQ---GQNSALEKRLQALETKQQEELASILSKKAKLLNT--LSRQSAALTNIERGLRGVRHN 247

  Fly   126 DIQIQLSAAKIKQ---MSNELVTQCSR--------------QDTCPIDGKG----GIYKLKI--- 166
            ...:|.....::|   :...||.:.:.              ||...|...|    |:|.:::   
Human   248 SSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQDCAEIQRSGASASGVYTIQVSNA 312

  Fly   167 -RELPAFEAPCSSNG-WLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHE 229
             :....|....||.| |..||:|.:|..||.|.|||||.|||...||.::|.|.||.:||:..:.
Human   313 TKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYS 377

  Fly   230 LYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAG-DSLRPHERQKFTTNDKDNDAYR 293
            |.::|...:|..::|.|::|.||.|.:.|.|..:| |:|:|| .|....:...|:|.|.|||...
Human   378 LRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVG-YSGSAGRQSSLVLQNTSFSTLDSDNDHCL 441

  Fly   294 FNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGKTNGILWGSWHNNDWTYSLTFVEMMIRP 355
            ..||....||||:..|..|.|||.:| .......|.:||.|..:...  :|||....|||||
Human   442 CKCAQVMSGGWWFDACGLSNLNGVYY-HAPDNKYKMDGIRWHYFKGP--SYSLRASRMMIRP 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 77/202 (38%)
ANGPT4NP_057069.1 FReD 288..501 CDD:238040 81/217 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.