DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6788 and ANGPTL4

DIOPT Version :9

Sequence 1:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_005272541.1 Gene:ANGPTL4 / 51129 HGNCID:16039 Length:424 Species:Homo sapiens


Alignment Length:337 Identity:90/337 - (26%)
Similarity:143/337 - (42%) Gaps:71/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ETIKDLQTRIGHKNELLLLQAGQIKDQSARLNVLIKNMKVLRSECLNAQAEIKSKDIQIQLSAAK 135
            |.:..|||              |:|.|::|:..|..  ||.:.:....:..::.:.:|.|.....
Human   100 EVLHSLQT--------------QLKAQNSRIQQLFH--KVAQQQRHLEKQHLRIQHLQSQFGLLD 148

  Fly   136 IKQMSNELVTQCSR----QDTCPID-----------------------GKGGIYKLKIRELPAFE 173
            .|.:.:|:.....|    :...|:|                       .:.|:::::.:..|.|.
Human   149 HKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFL 213

  Fly   174 APC---SSNGWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRRHELYIKLG 235
            ..|   |..||..||:|:||:.:|:|.|:.||.|||...|||::||||||.:|..|...|.::|.
Human   214 VNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLR 278

  Fly   236 KIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLRPHE--RQKFTTNDKDNDAYR-FNCA 297
            ..||......: :..||||..:|.|:......|..|.:..|..  ...|:|.|:|:|..| .|||
Human   279 DWDGNAELLQF-SVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCA 342

  Fly   298 AD------------------EYGGWWYYDCAKSMLNGKFYKE-GRSRNGKTNGILWGSWHNNDWT 343
            ..                  ..||||:..|:.|.|||::::. .:.|.....||.|.:|...  .
Human   343 KSLSAPSVAQRPDHVPSPLTPAGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGR--Y 405

  Fly   344 YSLTFVEMMIRP 355
            |.|....|:|:|
Human   406 YPLQATTMLIQP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6788NP_573254.1 FReD 160..356 CDD:238040 72/221 (33%)
ANGPTL4XP_005272541.1 FReD 183..418 CDD:238040 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.